Transcript | Ll_transcript_26369 |
---|---|
CDS coordinates | 190-708 (+) |
Peptide sequence | MGEVAVMHSEPLQLECYGMNRMTENDVHTPKSNEPMPEEESNQSTDDINIIDLQGKGYMEHGCQHYRRRCLIRAPCCDEIFDCHHCHNEAKNDTNIDQKHRHNIPRHQVKQVICSLCGTEQEVQQNCINCGVCMGKYFCETCKLFDDDISKQQYHCSDCGICRYDMLIWLFV* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 67.19% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 67.19% of identity |
Eggnog | ring finger and CHY zinc finger(ENOG410XXHF) |
Kegg | Link to kegg annotations (4324695) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457803.1) |
Pfam | CHY zinc finger (PF05495.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer