Protein coding transcript 145237

• Transcript: Ll_transcript_26439
• CDS coordinates: 2-325 (+)
• Peptide sequence: GKPVYPRLPEVRMLDFHALMPGDGSCTELKYVELLESVIAMAKTTFNRVSMQSILAHQAGNLPQVGASLVTGLVDGNSDLAGDIQGEALMHKTYAARLMGGEASAPAA
• ORF Type: internal

Annotations of Ll_transcript_26439

• Blastp: BEACH domain-containing protein A2 from Arabidopsis with 73.83% of identity
• Blastx: BEACH domain-containing protein A2 from Arabidopsis with 73.83% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT4G02660)
• CantataDB: Link to cantataDB annotations (CNT0002534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428216.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;