Transcript | Ll_transcript_26444 |
---|---|
CDS coordinates | 1-582 (-) |
Peptide sequence | LQRGDIEVPVLEKLVMLLGMILEDGFLSSELENVVRFVIMSFDPPRMAPQSLIVRESMGKHVIIRNMLLEMLIDLQVAIKSEDLLEQWHKGVSSKLITYFLDEAVHPTSMRWVMTLVGVCLTSSPTFSLKFRTSGGYQGLVRVLRSFYDSPDIYYILFCLIFDKPVYPRLPEVRMLDFHALIPNDGNYAELKFV |
ORF Type | internal |
Blastp | Protein SPIRRIG from Arabidopsis with 84.02% of identity |
---|---|
Blastx | Protein SPIRRIG from Arabidopsis with 84.02% of identity |
Eggnog | beige BEACH domain containing protein(ENOG410XNQC) |
Kegg | Link to kegg annotations (AT1G03060) |
CantataDB | Link to cantataDB annotations (CNT0002534) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455527.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer