Transcript | Ll_transcript_26064 |
---|---|
CDS coordinates | 162-767 (+) |
Peptide sequence | MEEELHASSINNKTCALRSWIMIDHHGIETILDVDKYAIMRLLQIHARDLRILDPLLSYPSTIFGREKAIILNLEHIKAIITAKQVFLRDPKDDHVVPIVEELRRRLPEVNCSGQGEEDKSTQEGEGGEGNDFPFEFRALEVALEAICSFLDARTRELETASYPALDELTSKISSRNLDRVRKLKSSMTRLTNRVQKLACR* |
ORF Type | complete |
Blastp | Magnesium transporter MRS2-2 from Arabidopsis with 70.97% of identity |
---|---|
Blastx | Magnesium transporter MRS2-2 from Arabidopsis with 70.97% of identity |
Eggnog | Magnesium transporter(ENOG410XNNZ) |
Kegg | Link to kegg annotations (AT5G64560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444478.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer