Protein coding transcript 1454

• Transcript: Ll_transcript_329178
• CDS coordinates: 1314-1886 (+)
• Peptide sequence: MAAEDDKNLIEILENLNAIDVAKYMNYVSAPQAGAIATFSGTTRDTFDGKTVLELRYEAYVPMAIRCLKAVCSSARASWNLHSIAVAHRIGSVPVGETSVFIAVSSVHRADALEACRFLIDELKATVPIWKKEVYSNGEVWKENTEFLERRSELGNKEVGCCGKKAEIKVHDKMRCCGTKVRVDHEDSKN*
• ORF Type: complete

Annotations of Ll_transcript_329178

• Blastp: Molybdopterin synthase catalytic subunit from Arabidopsis with 68.45% of identity
• Blastx: Molybdopterin synthase catalytic subunit from Arabidopsis with 68.45% of identity
• Eggnog: Molybdopterin(COG0314)
• Kegg: Link to kegg annotations (AT2G43760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442964.1)
• Pfam: MoaE protein (PF02391.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;