Transcript | Ll_transcript_26089 |
---|---|
CDS coordinates | 213-584 (+) |
Peptide sequence | MKSFTPFLCFLLFLLSIQFESSLGSKRTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSDFANNLLQADGWIVEKISLLENPNQVRPKRFWGVYTKLKIFNMTDYKKGEIAF* |
ORF Type | complete |
Blastp | Inositol phosphorylceramide glucuronosyltransferase 1 from Arabidopsis with 77.19% of identity |
---|---|
Blastx | Inositol phosphorylceramide glucuronosyltransferase 1 from Arabidopsis with 70.54% of identity |
Eggnog | Glycosyl Transferase(COG5597) |
Kegg | Link to kegg annotations (AT5G18480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439927.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer