Protein coding transcript 145541

• Transcript: Ll_transcript_25984
• CDS coordinates: 55-594 (+)
• Peptide sequence: MLANQSSNNLFHFSTSTMAFSLSSSLISTLFPTLPSFFRSNHPPPPSTITSFSKKLHELVIQQHEVSKAIIEPRMKQLKTLIPMVLVSVQITFLLPLVDSSSDSWSYITPPARAVLYSPDTKVPRTGEVALRKSIPASPNMKAIQDSLEDISYLLRIPQRKPYGTMEGNVKKVLKVFII*
• ORF Type: complete

Annotations of Ll_transcript_25984

• Blastp: Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic from Arabidopsis with 65.42% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic from Arabidopsis with 74.76% of identity
• Eggnog: peptidyl-prolyl cis-trans isomerase activity(COG0652)
• Kegg: Link to kegg annotations (AT3G15520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453602.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;