Transcript | Ll_transcript_25989 |
---|---|
CDS coordinates | 355-975 (+) |
Peptide sequence | MKQLKTLIPMVLVSVQITFLLPLVDSSSDSWSYITPPARAVLYSPDTKVPRTGEVALRKSIPASPNMKAIQDSLEDISYLLRIPQRKPYGTMEGNVKKVLKIAVEEKDAILASIPPELKERGSLVHASLIDGKAGLQALLQSIKEQDADKVSISLASTLDTVAELELLQAPGLSFLLPEQYMQYPRSVTPTKNHVRHYADIVHRSL* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic from Arabidopsis with 67.03% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic from Arabidopsis with 74.76% of identity |
Eggnog | peptidyl-prolyl cis-trans isomerase activity(COG0652) |
Kegg | Link to kegg annotations (AT3G15520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453602.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer