Protein coding transcript 145667

• Transcript: Ll_transcript_26418
• CDS coordinates: 259-708 (+)
• Peptide sequence: MDMYIRVKRSKTTYFIKCKPSDKVLDIKEKLQELIDQPANDQRLVLPGTREVLEDSKTLAEQKVENDAVVALTFRKGNVYIIVFLISPPPGLQKVQEILLIYVRIQVQGMTESYIGSIIFNVRLIIDIDVGFPTTMARFCTMVCPRPLT*
• ORF Type: complete

Annotations of Ll_transcript_26418

• Blastp: Elongin-B from Homo with 29.81% of identity
• Blastx: -
• Eggnog: Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)(ENOG4111UGJ)
• Kegg: Link to kegg annotations (6923)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415744.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;