Transcript | Ll_transcript_26420 |
---|---|
CDS coordinates | 259-708 (+) |
Peptide sequence | MDMYIRVKRSKTTYFIKCKPSDKVLDIKEKLQELIDQPANDQRLVLPGTREVLEDSKTLAEQKVENDAVVALTFRKGNVYIIVFLISPPPGLQKVQEILLIYVRIQVQGMTESYIGSIIFNVRLIIDIDVGFPTTMARFCTMVCPRPLT* |
ORF Type | complete |
Blastp | Elongin-B from Homo with 29.81% of identity |
---|---|
Blastx | - |
Eggnog | Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)(ENOG4111UGJ) |
Kegg | Link to kegg annotations (6923) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415744.1) |
Pfam | Ubiquitin family (PF00240.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer