| Transcript | Ll_transcript_469795 |
|---|---|
| CDS coordinates | 242-754 (+) |
| Peptide sequence | MLIDCKHFKSGNGNCPFGNICFYKHTVKPGSYTWIHNRPPPQRRPNNYDMYDMLDMLSEVNLSSEELYSIMRGSGLYNDMDPFEMMAISDAMASGDGPCLGPFDSDDDEVNMDFSRMTSLSEALASGVDDIGPEDFGNDEMAHMEAALLSMMMHSNIEEEEEEEYSDEYY* |
| ORF Type | complete |
| Blastp | E3 ubiquitin-protein ligase makorin from Arabidopsis with 71.43% of identity |
|---|---|
| Blastx | - |
| Eggnog | Ring finger protein(ENOG410XRM0) |
| Kegg | Link to kegg annotations (AT3G08505) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425357.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer