Protein coding transcript 145800

• Transcript: Ll_transcript_186594
• CDS coordinates: 252-779 (+)
• Peptide sequence: MDRLRPRNRTQFSGFTNAEIEKMEKLLMESRERSLDREFCQSLASRFNRSSGRAGKPLVKGTEIQSWFQTRLQDLPEVPNNEPVSPKDIECKEGACSVEEDNDNEGEMIRDPSELEFEARSSKDGAWYDVEMFLAHRYLSTGEAVSFNYHYNAHSFVLKDLISFALKNGGKYFGS*
• ORF Type: complete

Annotations of Ll_transcript_186594

• Blastp: Protein SAWADEE HOMEODOMAIN HOMOLOG 1 from Arabidopsis with 34.48% of identity
• Blastx: Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 63.27% of identity
• Eggnog: NA(ENOG411141H)
• Kegg: Link to kegg annotations (AT1G15215)
• CantataDB: Link to cantataDB annotations (CNT0001646)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438431.1)
• Pfam: SAWADEE domain (PF16719.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;