| Transcript | Ll_transcript_186596 |
|---|---|
| CDS coordinates | 278-673 (+) |
| Peptide sequence | MGVLYRVLFSICNDLNRLFPCKQIEKMEKLLMESRERSLDREFCQSLASRFNRSSGRAGKPLVKGTEIQSWFQTRLQDLPEVPNNEPVSPKDIECKEGACSVEEDNDNEGEMIRDPSELEFEARSSKDGAW* |
| ORF Type | complete |
| Blastp | Protein SAWADEE HOMEODOMAIN HOMOLOG 1 from Arabidopsis with 29.37% of identity |
|---|---|
| Blastx | Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 63.04% of identity |
| Eggnog | NA(ENOG411141H) |
| Kegg | Link to kegg annotations (AT1G15215) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438431.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer