Protein coding transcript 145818

• Transcript: Ll_transcript_187293
• CDS coordinates: 607-1053 (+)
• Peptide sequence: MKLTKSEETLSRKCIAFQEPCEIGCYSRVEGGQVYFDDRSLRLFKRLITEDVGADLNEGYDTFVPKKDLGSEGFGDLLACIRDKNIPLQNIHFVTYRNNLNKILATAYARHEPWEMGVHKRNGVVYLDVHSLPERPQRDIDRRRYIEA*
• ORF Type: complete

Annotations of Ll_transcript_187293

• Blastp: Decapping nuclease DXO homolog, chloroplastic from Arabidopsis with 75.69% of identity
• Blastx: Decapping nuclease DXO homolog, chloroplastic from Arabidopsis with 68.37% of identity
• Eggnog: Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping and pyrophosphohydrolase activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates(ENOG410ZAFR)
• Kegg: Link to kegg annotations (AT4G17620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422194.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;