Transcript | Ll_transcript_186801 |
---|---|
CDS coordinates | 506-1288 (+) |
Peptide sequence | MGSLTKSLFLLLLLILFTNLWPPQLAESASDYTTLVYKGCSKNTFTDPSGVYSQALSSLFGSLVSQSTKVKFFKATSGTGQTTITGLFQCRGDLTNTDCYNCVSKLPVLADKLCGKTIASRVQLLGCYMLYEVAGFEQISGMQMLFKTCGGKNGNGRAFEEKRDTAFSVMENGVVNGHGFYATSYQSLYVMGQCEGDVGDSDCGECVKNAVQKAEVECGGSVSGQVYLHKCFISYSYYSNGVPRRHPSFGSSSPSSSGIH* |
ORF Type | complete |
Blastp | Cysteine-rich repeat secretory protein 3 from Arabidopsis with 70.46% of identity |
---|---|
Blastx | Cysteine-rich repeat secretory protein 3 from Arabidopsis with 74.21% of identity |
Eggnog | cysteine-rich repeat secretory protein(ENOG410YCB5) |
Kegg | Link to kegg annotations (AT1G04520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426563.1) |
Pfam | Salt stress response/antifungal (PF01657.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer