Protein coding transcript 145930

• Transcript: Ll_transcript_186803
• CDS coordinates: 506-1288 (+)
• Peptide sequence: MGSLTKSLFLLLLLILFTNLWPPQLAESASDYTTLVYKGCSKNTFTDPSGVYSQALSSLFGSLVSQSTKVKFFKATSGTGQTTITGLFQCRGDLTNTDCYNCVSKLPVLADKLCGKTIASRVQLLGCYMLYEVAGFEQISGMQMLFKTCGGKNGNGRAFEEKRDTAFSVMENGVVNGHGFYATSYQSLYVMGQCEGDVGDSDCGECVKNAVQKAEVECGGSVSGQVYLHKCFISYSYYSNGVPRRHPSFGSSSPSSSGIH*
• ORF Type: complete

Annotations of Ll_transcript_186803

• Blastp: Cysteine-rich repeat secretory protein 3 from Arabidopsis with 70.46% of identity
• Blastx: Cysteine-rich repeat secretory protein 3 from Arabidopsis with 74.21% of identity
• Eggnog: cysteine-rich repeat secretory protein(ENOG410YCB5)
• Kegg: Link to kegg annotations (AT1G04520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426563.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;