Protein coding transcript 145937

• Transcript: Ll_transcript_186902
• CDS coordinates: 565-918 (+)
• Peptide sequence: MVKAKIKESKSKDEAESLKFTQKNLINKIYTDSAEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQLVTEFQEKDAIKAAVVLYFPSFIY*
• ORF Type: complete

Annotations of Ll_transcript_186902

• Blastp: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Homo with 40.37% of identity
• Blastx: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 63.51% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (50485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419020.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;