Protein coding transcript 145938

• Transcript: Ll_transcript_186903
• CDS coordinates: 565-1263 (+)
• Peptide sequence: MVKAKIKESKSKDEAESLKFTQKNLINKIYTDSAEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQLVTEFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVSSVNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSANQPENCSAKQKTLDEFVRRCDGRDELEHQSNPKRSRP*
• ORF Type: complete

Annotations of Ll_transcript_186903

• Blastp: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 53.94% of identity
• Blastx: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 53.94% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (734728)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419020.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;