Protein coding transcript 14594

• Transcript: Ll_transcript_469992
• CDS coordinates: 56-550 (+)
• Peptide sequence: MLHAASAPAFCATYPRNLHCPRYIINPSVKAKFSVRCSVPQTNNEAKVEFTPWLIVGLGNPGTKYHGTRHNVGFEIIDSVSRAEGIRMNTIQSKALIGIGSIGEVPVLLAKPQTYINFSGESVGPLAAYYRVPLRHILVVYDEMSLPNGVLRLQQKGGHGHHNG*
• ORF Type: complete

Annotations of Ll_transcript_469992

• Blastp: Chloroplastic group IIB intron splicing facilitator CRS2, chloroplastic from Oryza sativa with 81.9% of identity
• Blastx: Chloroplastic group IIB intron splicing facilitator CRS2-A, chloroplastic from Arabidopsis with 61.04% of identity
• Eggnog: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity)(COG0193)
• Kegg: Link to kegg annotations (4325801)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418975.1)
• Pfam: Peptidyl-tRNA hydrolase (PF01195.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;