Protein coding transcript 146060

• Transcript: Ll_transcript_186817
• CDS coordinates: 1-756 (+)
• Peptide sequence: RAQRLHQSQELEGQPVEMDTVSIIATFPSEIREEVLLTSSDAVLANLTPSLVAEANMLRERFAHRYSHTVFNSRGRRGETSRHGGGIIGLDGARGSISSRRSGGAKVVEADGAPLVDTKALHAMIRLFRIVQPLYKGQLQRLLLNLCAHSETRTSLVKILMDLLLLDARKTSSYFNKVEPPYRLYGCQNNVMYSRPQSFDGVPPLLSRRILETLTYLARNHPYVANNLLQFRLHHPASREANSADVACGKAV
• ORF Type: internal

Annotations of Ll_transcript_186817

• Blastp: E3 ubiquitin-protein ligase UPL1 from Arabidopsis with 49.38% of identity
• Blastx: E3 ubiquitin-protein ligase UPL1 from Arabidopsis with 47.92% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (AT1G55860)
• CantataDB: Link to cantataDB annotations (CNT0001834)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;