Transcript | Ll_transcript_186820 |
---|---|
CDS coordinates | 3-473 (+) |
Peptide sequence | TQDLKRRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNELTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGAKVTYHDIEAIDPDYFKNLKWMLENDITDVLDLTFSIDADEEKLILYERTEVTDYELI |
ORF Type | internal |
Blastp | E3 ubiquitin-protein ligase UPL1 from Arabidopsis with 89.68% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase UPL1 from Arabidopsis with 89.68% of identity |
Eggnog | ubiquitin protein ligase(COG5021) |
Kegg | Link to kegg annotations (AT1G55860) |
CantataDB | Link to cantataDB annotations (CNT0001834) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416613.1) |
Pfam | HECT-domain (ubiquitin-transferase) (PF00632.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer