Protein coding transcript 146156

• Transcript: Ll_transcript_186936
• CDS coordinates: 226-537 (+)
• Peptide sequence: MAREVVAEVCDIVTERGARIAGAGIIGIVKKLGRIETRKSVVTVEGGLYEHYRIFRNYLHSSVWEMLGSDLSDNVIIEHSHGGSGTGALFLAAAQTQTPRGDI*
• ORF Type: complete

Annotations of Ll_transcript_186936

• Blastp: Probable hexokinase-like 2 protein from Arabidopsis with 74.68% of identity
• Blastx: Probable hexokinase-like 2 protein from Arabidopsis with 76.92% of identity
• Eggnog: hexokinase(COG5026)
• Kegg: Link to kegg annotations (AT4G37840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445556.1)
• Pfam: Hexokinase (PF03727.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;