Protein coding transcript 146334

• Transcript: Ll_transcript_187046
• CDS coordinates: 240-1061 (+)
• Peptide sequence: MGRSPCCEKAHTNKGAWTKEEDDRLISYIHAHGEGSWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEQEDELIIKLHSLLGNKWSLIAGRLAGRTDNEIKNYWNTHIRRKLLNRGIDPATHRPLNDQEVQASVAATNTISFASSASAAIVKQEQDTSITSESSIFCVVGENNSKVGKGTLLERCPDLNLELTMSPPRLNEPDEAFKNMERTLCFGCSLGLQNSNHCKCGDGGNIGNISSGNRNSGTATSYDFLGLKTGVLDYRRLEMK*
• ORF Type: complete

Annotations of Ll_transcript_187046

• Blastp: Myb-related protein 308 from Antirrhinum with 67.34% of identity
• Blastx: Myb-related protein 308 from Antirrhinum with 66.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454241.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;