| Transcript | Ll_transcript_187056 |
|---|---|
| CDS coordinates | 223-693 (+) |
| Peptide sequence | MSRGIDPATHRPLNDADNLAQDQEIQPFAAVTKTLSFASSASAVVKQEQETSITSKSSTFCGVVENNNNNNNNKDGKGTMLEHCPDLNLELTISPPRLNESDQPFKNMERSLCFGLQNSNKDCNSVDGNSTGTSYDFLGLKTTGVWDYRRLEMKLN* |
| ORF Type | complete |
| Blastp | Myb-related protein 308 from Antirrhinum with 35.25% of identity |
|---|---|
| Blastx | Myb-related protein 308 from Antirrhinum with 43.45% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450978.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer