| Transcript | Ll_transcript_187041 |
|---|---|
| CDS coordinates | 329-706 (+) |
| Peptide sequence | MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGSWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDEVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWRSRVLKQAKQLKCDVNSK |
| ORF Type | 3prime_partial |
| Blastp | Myb-related protein 308 from Antirrhinum with 92.86% of identity |
|---|---|
| Blastx | Myb-related protein 308 from Antirrhinum with 92.86% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450979.1) |
| Pfam | Myb-like DNA-binding domain (PF00249.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer