Protein coding transcript 146345

• Transcript: Ll_transcript_187055
• CDS coordinates: 1052-1552 (+)
• Peptide sequence: MSRGIDPATHRPLNDAENRVQDHEVQASAAAPNAISFASPVSAAAAAVKQEQDPSITSKSSMFGVFGEINNKDGRGTLLERCPDLNLELTISPPRLNEPEQPFKNMDRSLFFGCNLGMKNSSDYSCGDGSDIGNSTSSGKRNSGSTGYDFLGLKTDVWDYRRLKMK*
• ORF Type: complete

Annotations of Ll_transcript_187055

• Blastp: Myb-related protein 308 from Antirrhinum with 36.88% of identity
• Blastx: Myb-related protein 308 from Antirrhinum with 47.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412991.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;