Protein coding transcript 14635

• Transcript: Ll_transcript_469598
• CDS coordinates: 3-899 (+)
• Peptide sequence: PSEDYWFKLRLRHSTAFRPPHHYRRCIAETFKECPSVAVKLMETLLSVEPVHRRTAATALKSEFFSSEPLACDPSTLPKYPPCKEIDSKLRDEAMKRQQEDAGGKERKVGSGVRQEKEPRAFVSSKDNTKSHIQFQQGQHLSSSKSRSGLLNPHREPVSGFLVFPHKQSEDVKERDIYFTRHSKKPSFSGPLAPGSDWEVGERPPVSNKVNLSKIPGSAASRSSLSRDQKEKPVPLWPQKPIQDGHGSRGRNIHSSGPLLVSANNMDEMLKERDRKFQEYSRRARIEKSKGEKVYAKQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_469598

• Blastp: Probable serine/threonine-protein kinase At1g09600 from Arabidopsis with 33.65% of identity
• Blastx: Probable serine/threonine-protein kinase At1g09600 from Arabidopsis with 33.65% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPIR)
• Kegg: Link to kegg annotations (AT1G09600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431399.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;