Protein coding transcript 146370

• Transcript: Ll_transcript_187274
• CDS coordinates: 493-1227 (+)
• Peptide sequence: MQLFHDLERNGHHVEVPWDKVTVLFNLARLLEQLNESGTASILYRLILFKYPDYVDAYLRLAAIAKARNNILLSIELVNDALKVNDKCPNALSMLGELELKNDDWVKAKETLRAASDATDGKDSYATLSLGNWNYFAAVRNEKRNPKLEATHLEKAKELYTRVLIQHSANLYAANGAGVALAEKGHFDVSKDIFTQVQEAASGSVFVQMPDVWINLAHVYFAQGSFSLAVKMVSLFPIFTLFPF*
• ORF Type: complete

Annotations of Ll_transcript_187274

• Blastp: Protein CTR9 homolog from Arabidopsis with 78.26% of identity
• Blastx: Protein CTR9 homolog from Arabidopsis with 73.95% of identity
• Eggnog: repeat-containing protein(COG0457)
• Kegg: Link to kegg annotations (AT2G06210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415251.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;