Transcript | Ll_transcript_186778 |
---|---|
CDS coordinates | 3-443 (+) |
Peptide sequence | YVQKVNPGNTHLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARYVVE |
ORF Type | internal |
Blastp | Clathrin heavy chain 2 from Oryza sativa with 97.28% of identity |
---|---|
Blastx | Clathrin heavy chain 1 from Oryza sativa with 97.28% of identity |
Eggnog | clathrin heavy chain(ENOG410XPH1) |
Kegg | Link to kegg annotations (4351255) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016166957.1) |
Pfam | Region in Clathrin and VPS (PF00637.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer