Protein coding transcript 146384

• Transcript: Ll_transcript_186779
• CDS coordinates: 79-393 (+)
• Peptide sequence: MWLFFAFRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNSEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARYVVE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_186779

• Blastp: Clathrin heavy chain 2 from Oryza sativa with 97.96% of identity
• Blastx: Clathrin heavy chain 2 from Oryza sativa with 97.8% of identity
• Eggnog: clathrin heavy chain(ENOG410XPH1)
• Kegg: Link to kegg annotations (4351255)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414955.1)
• Pfam: Region in Clathrin and VPS (PF00637.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;