Transcript | Ll_transcript_143888 |
---|---|
CDS coordinates | 3-695 (+) |
Peptide sequence | GLGWAGLHAHSRVHLTEKKERRREGMECAAKGSGTRCTGLATRPCARCGAVSYCSLSHQIAHWGQHKLECDRLEQQMESVHFINDFPFTFSREATLQVCVKQETRCSFLSKRGLHQVGMWMNECSCWASYDRFECSRLNSGWDLPSISCPCCGPESLLSEQLHSWRDYYKWRHIPLDSPVAVLLHWPLTIFHAAQLVGITALNPEGLRKSCYNLLSLGSYWHSSLVYIFI* |
ORF Type | 5prime_partial |
Blastp | Zinc finger MYND domain-containing protein 15 from Mus with 31.55% of identity |
---|---|
Blastx | Zinc finger MYND domain-containing protein 15 from Mus with 31.55% of identity |
Eggnog | zinc finger, MYND-type containing 15(ENOG4111I8B) |
Kegg | Link to kegg annotations (574428) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445499.1) |
Pfam | MYND finger (PF01753.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer