| Transcript | Ll_transcript_144220 |
|---|---|
| CDS coordinates | 401-808 (+) |
| Peptide sequence | MGNCLNKSQSKDNDSDYHVEFAAGNVKLITTKEAWDQKSEEAKRDGKIVVANFTATWCGPCKMIAPLYSELSEKYTSFMFLLVDVDELADFSSSWDIKATPTFFFLRDGKEFDKLVGANKPELEKKIDAVTKSLP* |
| ORF Type | complete |
| Blastp | Thioredoxin H-type from Populus with 69.63% of identity |
|---|---|
| Blastx | Thioredoxin H-type from Populus with 69.63% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450408.1) |
| Pfam | Thioredoxin (PF00085.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer