Transcript | Ll_transcript_143929 |
---|---|
CDS coordinates | 262-1074 (+) |
Peptide sequence | MVRFYSLMGFLPFPLLSPSHCCKEPEKTIQEIAEGLLYSSISVKVIEADEDQRSLMFSEKEASWSRYSKQVKVGDIFEVKVSCIEDYGAFVDLRFPDGLYHLHGLIHISEMSWDLVDNVRDILTECDVVKAKVVRVDREKSRISLSIKRLEEDPLLQNLGTVVPQNGLACPNSRGGGNRSRILPLPGLERILEELLQEDGIDDARIRRHGFEKRAVSQDLQIWLSDERQTNRRINLLARAGKQMQEIQLITSLDQEGIQRALQRVFERIP* |
ORF Type | complete |
Blastp | 30S ribosomal protein S1, chloroplastic from Spinacia with 32.43% of identity |
---|---|
Blastx | 30S ribosomal protein S1, chloroplastic from Spinacia with 30% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460458.1) |
Pfam | S1 RNA binding domain (PF00575.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer