Transcript | Ll_transcript_143944 |
---|---|
CDS coordinates | 2-424 (+) |
Peptide sequence | KFLFLILKKIVRIGEWRSLLHSVCSLRCSISVTSSMAPSMRIIFGLLTFVTIGMIIGALSQLAFIRKLEDSYGTETLPFRRLRGLESNGYIQFPRGINIWNNDKEAEILRLGYVKPEVLSWSPRIILLHNFLSMEVCPSF* |
ORF Type | 5prime_partial |
Blastp | Prolyl 4-hydroxylase 1 from Arabidopsis with 61.76% of identity |
---|---|
Blastx | Prolyl 4-hydroxylase 1 from Arabidopsis with 61.76% of identity |
Eggnog | prolyl 4-hydroxylase(ENOG410XS5J) |
Kegg | Link to kegg annotations (AT2G43080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452515.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer