Protein coding transcript 1465

• Transcript: Ll_transcript_329127
• CDS coordinates: 73-1152 (+)
• Peptide sequence: MFLVVLVQSKPIPTYRGFGNNAFNGNKDFDLPDYQKDFEPEKLNGEQVKNVNGTLREGFYSQSCPNAEKIVADELALIAKTNPNAVPNLLRLQFHDCFVGGCDASILLDVLPSGEEVEKTSLLNGLLLKGTDIIDDIKAKLEQECPQTVSCSDTLAFATNEAISLAGLPRQAPLGGRRDSIVSLAMLAEDNNLPLPNWSVDKMLAIFEKKGFTAEEMVILLGAHSVGSSHCDMFNERLYDFKGTQKPDPALAAPFVDELRKTCTAPGTPQYRNPPVNFDETPTVLDNLFYKNLAEKRRSLLMTDDVLLDDPRTAPTVKKMAAEPELFAKRFPEMMVKLSSLNVLTGNDGEVRIICRSTN*
• ORF Type: complete

Annotations of Ll_transcript_329127

• Blastp: Peroxidase 57 from Arabidopsis with 41.64% of identity
• Blastx: Peroxidase 57 from Arabidopsis with 41.64% of identity
• Eggnog: peroxidase(ENOG4110UVG)
• Kegg: Link to kegg annotations (AT5G17820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445422.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;