Protein coding transcript 146520

• Transcript: Ll_transcript_143831
• CDS coordinates: 156-644 (+)
• Peptide sequence: MEVEGEAEIDRLPIDLLAHIFSLFTSFTDMAQASSVCKKWKQGVKESLARRQNLSFAGWKMDDDSTARLVWHAYNLKKLDIPRSRWGCQITDAGLCRISFAKCVSNLTSISLWGLTGITDEGVVQLVCQCSGSGTYMGLRDFAWLDLTIFCFETFYFLVIHQ*
• ORF Type: complete

Annotations of Ll_transcript_143831

• Blastp: F-box protein At5g67140 from Arabidopsis with 68.46% of identity
• Blastx: F-box protein At5g67140 from Arabidopsis with 68.46% of identity
• Eggnog: F-box and leucine-rich repeat protein(ENOG410XQ54)
• Kegg: Link to kegg annotations (AT5G67140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423356.1)
• Pfam: F-box-like (PF12937.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;