Protein coding transcript 146581

• Transcript: Ll_transcript_144106
• CDS coordinates: 147-692 (+)
• Peptide sequence: MFSTNTSSLFFPATPSTFRCRASAADLSPSFPRFFHSLTSAATTIGVRIGQGPDSSYIETGTRRGSSNDGMKPKAKEKNWSRNRESYLVDDSEPLPLPMTHPDSSPVSADEIDKRLQCDPKFEDCKEVVYEWTGKCRSCQGSGYVSYYSKRGKETTCKCIPCVGIGNPSFTIYAHLHTFFL*
• ORF Type: complete

Annotations of Ll_transcript_144106

• Blastp: Protein disulfide-isomerase SCO2 from Arabidopsis with 53.37% of identity
• Blastx: Protein disulfide-isomerase SCO2 from Arabidopsis with 53.37% of identity
• Eggnog: NA(ENOG411219R)
• Kegg: Link to kegg annotations (AT3G19220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424378.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;