Protein coding transcript 146651

• Transcript: Ll_transcript_143674
• CDS coordinates: 1052-1849 (+)
• Peptide sequence: MLLVIFGGVWAIYPIVLSLSLLCGVFHSTIIAILSIATITFFSLAAFRCAGTPPTILWGSYPTVGKGDLENYTFCQYCSKPKSPRAHHCRSCGKCILDMDHHCPFIGNCVGASNHRNFIFFLISAVSSTIYISIMAAYASTCIWPPLKYSLGRSNGMSQQYPAWRVINEIIVAFLGSALLLSSRGLVLLYLFISSLSLQIGLIVLLWQQLYYIYQGKTYLSNLSSPTDNEEEKKDFQNLVRFFGFQYPVTRLLPTFHVSRKRHVK*
• ORF Type: complete

Annotations of Ll_transcript_143674

• Blastp: Protein S-acyltransferase 11 from Arabidopsis with 53.73% of identity
• Blastx: Protein S-acyltransferase 11 from Arabidopsis with 52.34% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G18620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420633.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;