Protein coding transcript 146672

• Transcript: Ll_transcript_143686
• CDS coordinates: 950-1378 (+)
• Peptide sequence: MDGQSKGVSVEQVQSDHSRGGKRKKPCSAKKLKEDSHAGEPVTAEKPIGTSASTFEPARTGNADHEGNNSKKKTVLVNPLCNIIKILRPLGCSPTASAENLCVTFMALRSDGTEVIVDNRYLKSHYPQLLIEYYEQRIRYNP*
• ORF Type: complete

Annotations of Ll_transcript_143686

• Blastp: Chromo domain-containing protein LHP1 from Arabidopsis with 40.6% of identity
• Blastx: Chromo domain-containing protein LHP1 from Arabidopsis with 36.22% of identity
• Eggnog: chromobox homolog(ENOG4111JKD)
• Kegg: Link to kegg annotations (AT5G17690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465358.1)
• Pfam: Chromo shadow domain (PF01393.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;