Protein coding transcript 146690

• Transcript: Ll_transcript_143877
• CDS coordinates: 194-838 (+)
• Peptide sequence: MSFREGNECEESKSVSQNVSLTNSQLTVDESLLVDPKLLFIGDKIGEGAHGKVYKGRYHDQIVAIKVLHRGSTSEERAALENRFAREVIMMSRVHHENLVKFIGACKDPLMVIVTELLPGMSLRKYLMSVRPKQLELHVAINFALDIAKAMDWLHANGIIHRDLKPDNLLLTANQKSVKLADFGLAREESVTEMMTAETGTYRWMAPEVCSILH*
• ORF Type: complete

Annotations of Ll_transcript_143877

• Blastp: Serine/threonine-protein kinase STY46 from Arabidopsis with 51.7% of identity
• Blastx: Serine/threonine-protein kinase HT1 from Arabidopsis with 41.84% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G38470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412787.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;