Protein coding transcript 146694

• Transcript: Ll_transcript_143722
• CDS coordinates: 2-397 (+)
• Peptide sequence: PMYPPGGPGIGQQIFYGQGPPAMIPSQPGFGYQQQLVPGMRPGGAPMPNFFMPMVQQGQQGQRPGGRRAGGVQQSQQPVPLIPQQMLPRGRVYRYPPPGRGIPEGPIPGVAGGMFSVPYDVGGIPIHDAGLS
• ORF Type: internal

Annotations of Ll_transcript_143722

• Blastp: Polyadenylate-binding protein 4 from Arabidopsis with 58.91% of identity
• Blastx: Polyadenylate-binding protein 8 from Arabidopsis with 91.18% of identity
• Eggnog: poly(A) binding protein, cytoplasmic(ENOG410XR5X)
• Kegg: Link to kegg annotations (AT2G23350)
• CantataDB: Link to cantataDB annotations (CNT0002568)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421446.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;