Transcript | Ll_transcript_143737 |
---|---|
CDS coordinates | 130-705 (+) |
Peptide sequence | MVKQLTFLLLLLIIIIPFFAFGFTESQSSYVLMPHAADSFNVSYIQINNAGTCSYSLVISTSCSSPKYTRDQISIAFGDAYANQIYAPRLDDPASGTFESCSSDTFQINGPCAYQICYVYLYRSGYEGWKPESVKISGYNSRPVTFYYNTYIPSDTWYGFNLCNHASSSFQVSTKTWFICIGLGLFLNFWI* |
ORF Type | complete |
Blastp | Embryo-specific protein ATS3B from Arabidopsis with 60.84% of identity |
---|---|
Blastx | Embryo-specific protein ATS3B from Arabidopsis with 69.85% of identity |
Eggnog | Embryo-specific protein 3, (ATS3)(ENOG410YRBB) |
Kegg | Link to kegg annotations (AT5G62200) |
CantataDB | Link to cantataDB annotations (CNT0000105) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442171.1) |
Pfam | Embryo-specific protein 3, (ATS3) (PF06232.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer