Protein coding transcript 146705

• Transcript: Ll_transcript_143744
• CDS coordinates: 130-705 (+)
• Peptide sequence: MVKQLTFLLLLLIIIIPFFAFGFTESQSSYVLMPHAADSFNVSYIQINNAGTCSYSLVISTSCSSPKYTRDQISIAFGDAYANQIYAPRLDDPASGTFESCSSDTFQINGPCAYQICYVYLYRSGYEGWKPESVKISGYNSRPVTFYYNTYIPSDTWYGFNLCNHASSSFQVSTKTWFICIGLGLFLNFWI*
• ORF Type: complete

Annotations of Ll_transcript_143744

• Blastp: Embryo-specific protein ATS3B from Arabidopsis with 60.84% of identity
• Blastx: Embryo-specific protein ATS3B from Arabidopsis with 69.85% of identity
• Eggnog: Embryo-specific protein 3, (ATS3)(ENOG410YRBB)
• Kegg: Link to kegg annotations (AT5G62200)
• CantataDB: Link to cantataDB annotations (CNT0000105)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442171.1)
• Pfam: Embryo-specific protein 3, (ATS3) (PF06232.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;