Protein coding transcript 14674

• Transcript: Ll_transcript_469959
• CDS coordinates: 2-334 (+)
• Peptide sequence: FEEYEDAPVLGKPTIFTTDNMGEKIQWAQCEDCLKWRKLPASALLPSKWTCSDNSWDPERSSCSAAQELTAEQLENMLPPCSSAVSKKMKAAKQDPDNAEALEGLDTLANL
• ORF Type: internal

Annotations of Ll_transcript_469959

• Blastp: B3 domain-containing protein Os07g0563300 from Oryza sativa with 62.16% of identity
• Blastx: B3 domain-containing protein Os07g0563300 from Oryza sativa with 60.36% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (4343608)
• CantataDB: Link to cantataDB annotations (CNT0000445)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425640.1)
• Pfam: CW-type Zinc Finger (PF07496.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;