Protein coding transcript 146820

• Transcript: Ll_transcript_144289
• CDS coordinates: 3752-4063 (+)
• Peptide sequence: MGFNAVAILVQDFDAVMNKGFFHGYSFVTVLMIFNHALSGIAVSMVMKYADNIVKVYSTSVAMILTAIVSVFLFGFHLSLAFFLGTIVVSVAIYLHSAGKIQR*
• ORF Type: complete

Annotations of Ll_transcript_144289

• Blastp: CMP-sialic acid transporter 2 from Oryza sativa with 87.25% of identity
• Blastx: CMP-sialic acid transporter 2 from Oryza sativa with 86.61% of identity
• Eggnog: membrane(COG0697)
• Kegg: Link to kegg annotations (4343687)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460205.1)
• Pfam: Nucleotide-sugar transporter (PF04142.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;