Protein coding transcript 146829

• Transcript: Ll_transcript_144295
• CDS coordinates: 3458-3886 (+)
• Peptide sequence: MAIVMALLSGFAGVYTEAIIKKRPSRDINVQNFWLYIFGMGFNAVAILVQDFDAVMNKGFFHGYSFVTVLMIFNHALSGIAVSMVMKYADNIVKVYSTSVAMILTAIVSVFLFGFHLSLAFFLGTIVVSVAIYLHSAGKIQR*
• ORF Type: complete

Annotations of Ll_transcript_144295

• Blastp: CMP-sialic acid transporter 2 from Oryza sativa with 90.07% of identity
• Blastx: CMP-sialic acid transporter 2 from Oryza sativa with 90.32% of identity
• Eggnog: membrane(COG0697)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460205.1)
• Pfam: Nucleotide-sugar transporter (PF04142.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;