Protein coding transcript 146830

• Transcript: Ll_transcript_144296
• CDS coordinates: 687-1067 (+)
• Peptide sequence: MEYRKMKDEEDEDRSVGVEDNIDKSFLISVPDNSNLVGETKLETHRTQVQWKRKSVVTLSLTILTSSQAILIVWSKRAGKYEYSVTTANFLVETLKCAISLLALARLWNKHGVTDDNRSSLSLSIQ*
• ORF Type: complete

Annotations of Ll_transcript_144296

• Blastp: CMP-sialic acid transporter 4 from Arabidopsis with 62.5% of identity
• Blastx: CMP-sialic acid transporter 2 from Oryza sativa with 91.89% of identity
• Eggnog: membrane(COG0697)
• Kegg: Link to kegg annotations (AT4G15200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460204.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;