Protein coding transcript 146939

• Transcript: Ll_transcript_144349
• CDS coordinates: 2425-2880 (+)
• Peptide sequence: MNIQFCCMCRCPVCLSEYQGEDLLHILPYCEHSFHVTCIDLWLQQNSTCPVCRISLREFPERKRLMQPMFSFTLRPQHSMESFDTDHYHCMMTNNGLSSRTPDNNRANPIQEDHFPPEGGLAVARDNIACLSQGGLIKDEGKKHVESPSNF*
• ORF Type: complete

Annotations of Ll_transcript_144349

• Blastp: RING-H2 finger protein ATL46 from Arabidopsis with 51.61% of identity
• Blastx: RING-H2 finger protein ATL58 from Arabidopsis with 40.96% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G40250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429157.1)
• Pfam: RING-H2 zinc finger domain (PF12678.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;