| Transcript | Ll_transcript_329209 |
|---|---|
| CDS coordinates | 235-597 (+) |
| Peptide sequence | MSMAHYLSSLEEELERTKQELQQLKQHETEKHPVEIEDVKFVENLTKFEINDFTSDEEKIEFHKKRYVTFANPPSVSHVMLPQGIEKLERNPSLGNKKKKKSLIAFIGGIFSRKKGNQVN* |
| ORF Type | complete |
| Blastp | WEB family protein At1g75720 from Arabidopsis with 41.54% of identity |
|---|---|
| Blastx | WEB family protein At1g75720 from Arabidopsis with 44.97% of identity |
| Eggnog | NA(ENOG410YQJI) |
| Kegg | Link to kegg annotations (AT1G75720) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457472.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer