Protein coding transcript 147002

• Transcript: Ll_transcript_143535
• CDS coordinates: 1363-2358 (+)
• Peptide sequence: MTGQDDIEKLVSKLEDKVRALEEGSCMDAIILPLHGSLPPELQVRVFSPPPPNCRRIIVATNIAETSLTVDGVVYVIDSGYVKQRQYNPSAGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSRVYDDEFLDATVPEIQRSSLAGCVLYLKSLDLPDIDILKFDFLDPPSSESLQDALKQLYLIDAIDENGAITSIGQKMAELPLEPSLSRTLMEANNYGCISEALTVAAMLSAETALLSAPGRSKTERKRKNPVTNLPDGSGLGDHIQLLQIYECWDQTDYDIGWCKDNGLQVRGMLFVKDVRKQLSQIMQKIAKVILSYGRCLKE*
• ORF Type: complete

Annotations of Ll_transcript_143535

• Blastp: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 from Arabidopsis with 81.1% of identity
• Blastx: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 from Arabidopsis with 69.22% of identity
• Eggnog: helicase(COG1643)
• Kegg: Link to kegg annotations (AT1G27900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460163.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;